PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold02395-augustus-gene-0.34-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family TALE
Protein Properties Length: 326aa    MW: 36809 Da    PI: 6.1727
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold02395-augustus-gene-0.34-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.9e-092552882255
                                                    SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                                       Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                                     +yps++++  LA+++gL+ +q+ +WF N+R ++
  maker-scaffold02395-augustus-gene-0.34-mRNA-1 255 WPYPSESQKVALAESTGLDLKQINNWFINQRKRH 288
                                                    58*****************************885 PP

2ELK391.7e-13208229122
                                            ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                                    ELK qLlrKYsgyLgsLkqEF+
  maker-scaffold02395-augustus-gene-0.34-mRNA-1 208 ELKTQLLRKYSGYLGSLKQEFL 229
                                                    9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012559.2E-1674118IPR005540KNOX1
PfamPF037904.4E-1976116IPR005540KNOX1
SMARTSM012565.4E-27125176IPR005541KNOX2
PfamPF037915.0E-22128175IPR005541KNOX2
SMARTSM011881.7E-7208229IPR005539ELK domain
PROSITE profilePS5121311.348208228IPR005539ELK domain
PfamPF037893.9E-10208229IPR005539ELK domain
PROSITE profilePS5007111.758228291IPR001356Homeobox domain
SMARTSM003891.2E-11230295IPR001356Homeobox domain
SuperFamilySSF466891.8E-19230305IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-27233293IPR009057Homeodomain-like
CDDcd000862.27E-12240292No hitNo description
PfamPF059205.2E-17248287IPR008422Homeobox KN domain
PROSITE patternPS000270266289IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MEGGASGNGT SCMMGFGDNN MMMPLMNSGH EANSNFKPFL PLPLNTNSYG QKTSGLMPPQ  60
DIVNRMETNN SSCMTMSSKI MAHPLFLRLL AAYVNCQKVG APPEVVARLE EVYANSEAAM  120
GGRSGTVCIG EDPGLDQFME AYCEMLTKYE QELSKPFKEA MLFFSRIECQ LKALTVSSSD  180
SAGGRIGSSE EEVDLNDNSI DPQAEDQELK TQLLRKYSGY LGSLKQEFLK KKKNGKLPKE  240
ARHRLLDWWS RHYKWPYPSE SQKVALAEST GLDLKQINNW FINQRKRHWK PSEDMQLFVM  300
DGTHPHYYMD NVMCNPFPMD CTNMLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273805.31e-154PREDICTED: homeobox protein knotted-1-like LET6
SwissprotP466081e-133HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA5C6E11e-154A5C6E1_VITVI; Putative uncharacterized protein
TrEMBLF6HIE01e-154F6HIE0_VITVI; Putative uncharacterized protein
STRINGVIT_12s0059g01190.t011e-154(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-116KNOX/ELK homeobox transcription factor